SPKB

Signal Peptide Knowledge Base

SPKB ID Signal sequence Length Organism
SPKB02112 MAFRLSSAVLLAALVAAPAYA 21 Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1) (Methylobacterium extorquens)
SPKB02113 MKRQLYLYVIFVVVELMVFTTKGYS 25 Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / CIP 104194 / JCM 7457 / NBRC 12017 / NCIMB 9290 / NRRL B-14731 / HIM 762-3)
SPKB02114 MSLLSIITIGLAGLGGLVNG 20 Leucosporidium sp. (strain AY30) (Arctic yeast)
SPKB02115 MAKHLIVMFLVIMVISSLVDC 21 Liocheles australasiae (Dwarf wood scorpion)
SPKB02116 MTSNNRHLFQATCLVLLLLHAAFHGGALG 29 Patiria pectinifera (Starfish) (Asterina pectinifera)
SPKB02117 MKVFVVLAAIVAIAN 15 Cryptopygus antarcticus (Antarctic springtail)
SPKB02118 MRGDVRVHTASPIAAAWLLAVGLVAHA 27 Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) (Chromatium vinosum)
SPKB02119 MTDWSRRRFLQTGAALGIAGTLPQTTTEVSA 31 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii)
SPKB02120 MRRFAAGCLALALLVLPFVLTGARA 25 Ancylobacter novellus (strain ATCC 8093 / DSM 506 / JCM 20403 / CCM 1077 / IAM 12100 / NBRC 12443 / NCIMB 10456) (Starkeya novella)
SPKB02121 MAGKPGIQLFVIFLLLSSFAAVVWA 25 Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta)
SPKB02122 MRFTLKTTAIVSAAALLAGFGPPPRA 26 Castellaniella defragrans (strain DSM 12143 / CCUG 39792 / 65Phen) (Alcaligenes defragrans)
SPKB02123 MNMSCKFEIVLLVSWWLLLVLVFGVESSMF 30 Dianthus caryophyllus (Carnation) (Clove pink)
SPKB02124 MKILIFIIASFMLIGVEC 18 Rhopalurus junceus (Caribbean blue scorpion)
SPKB02125 MAGKLGVLLLALVLSLAQPASA 22 Bos taurus (Bovine)
SPKB02126 MRATLFCLCLCLLGTVLP 18 Gallus gallus (Chicken)
SPKB02127 MALALWVFALLGSACLVSA 19 Sus scrofa (Pig)
SPKB02128 MRILWIVAVCLIGVEG 16 Vipera renardi (Steppe viper) (Vipera ursinii renardi)
SPKB02129 MRTLWIVAVCLIGVEG 16 Vipera renardi (Steppe viper) (Vipera ursinii renardi)
SPKB02130 MNKRFFPTLLLAFVCSTLAYA 21 Porphyromonas endodontalis (strain ATCC 35406 / DSM 24491 / JCM 8526 / CCUG 16442 / BCRC 14492 / NCTC 13058 / HG 370) (Bacteroides endodontalis)
SPKB02131 MKTIKDRIAKWSAIGLLSAVAATAFYAPSASA 32 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
SPKB02132 MKLKRLMAALTFVAAGVGAASAVA 24 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
SPKB02133 MKGFFAGVVAAATLAVASA 19 Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB02134 MSRFLIYFLPFFIYSGNVLS 20 Caenorhabditis elegans
SPKB02135 MNVFFMFSLLFLATLGSC 18 Daboia russelii (Russel's viper) (Vipera russelii)
SPKB02136 MDKMNPAHLLVLAAVCVSLLGASSIPPQAL 30 Micrurus tener tener (Texas coral snake)
SPKB02137 MAVASRKLGALVLVAVLCLSLPTGCLS 27 Tanacetum cinerariifolium (Dalmatian daisy) (Chrysanthemum cinerariifolium)
SPKB02138 MPFSRTLLALSLGMALLQNPAFA 23 Pseudomonas taetrolens
SPKB02139 MRSAFILALGLITASADALVTR 22 Microdochium nivale (Pink snow mold) (Lanosa nivalis)
SPKB02140 MEGMALYLVAALLIGFPGSSHG 22 Ophiophagus hannah (King cobra) (Naja hannah)
SPKB02141 MSSGGLLLLLGLLTLWAELTPVSS 24 Macrovipera lebetina transmediterranea (Blunt-nosed viper) (Vipera lebetina transmediterranea)
First 2 3 4 5 6 7 8 Last

Faculty of Applied Sciences, Macao Polytechnic University, Macao, China.