SPKB

Signal Peptide Knowledge Base

SPKB ID Signal sequence Length Organism
SPKB16995 MASKLFLAAALLQGALS 17 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB16996 MLSLKAVLRFASVAVAVVLPTLAQA 25 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB16997 MQLLATTLTFASGAAA 16 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB16998 MQFSLSIATAILAATASA 18 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB16999 MTIKFASLILAGLGLGSGALG 21 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB17000 MRWSSPTSSSLSLVALLLVAHVDA 24 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB17001 MQFATITTLLFAGVAA 16 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB17002 MASRLVAGLQVLALAGTATA 20 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB17003 MAKFSALCSLALLGLATA 18 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB17004 MVKLFCAIVGAAGSAFP 17 Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB17005 MRGVFFVAVAVAIFARSSAEA 21 Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB17006 MRLSSTTFVVLAAVLLASGTAVSKA 25 Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB17007 MLPVAVVLVVFAVAVTSA 18 Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB17008 MRLQCVVLFAALTLVAA 17 Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB17009 MKALWAVLVVTLLAGCRA 18 Heterocephalus glaber (Naked mole rat)
SPKB17010 MNECVNKLLHLKFLFYFILGIQ 22 Drosophila melanogaster (Fruit fly)
SPKB17011 MQALPLGLQLALLVAAGAG 19 Mus musculus (Mouse)
SPKB17012 MRRLSAILPILLLSNFWPTVES 22 Caenorhabditis elegans
SPKB17013 MVIVWYHQLLLVLLIFIGAAKG 22 Caenorhabditis elegans
SPKB17014 MSSERRKDNPLRFALILHLLAVLVQG 26 Caenorhabditis elegans
SPKB17015 MPPFYIVITFLLSTVFRISQS 21 Caenorhabditis elegans
SPKB17016 MSLFLFAIFQLALGSPG 17 Caenorhabditis elegans
SPKB17017 MIRTRHVFLFAVLLAFASS 19 Caenorhabditis elegans
SPKB17018 MLLICISVLAAISAHPLSS 19 Caenorhabditis elegans
SPKB17019 MSSRISVSLLLLAVVATMFFTANVVDA 27 Caenorhabditis elegans
SPKB17020 MKNLLLITFFVVSTVTA 17 Caenorhabditis elegans
SPKB17021 MHLKASSILALLVIGANA 18 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB17022 MPGQELKTLNGSQMLLVLLVLLWPPHGGA 29 Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
SPKB17023 MVFFKDLFIFKSLIKGSLYSGHMKKKLLNYLPLFALMLFTVSMMAQT 47 Nonlabens ulvanivorans (Persicivirga ulvanivorans)
SPKB17024 MLIRRPPDLLPSEITPEPLARGRRALLKGLGAGAALAGLGLPQISQA 47 Azospira oryzae (strain ATCC BAA-33 / DSM 13638 / PS) (Dechlorosoma suillum)
First 463 464 465 466 467 468 469 Last

Faculty of Applied Sciences, Macao Polytechnic University, Macao, China.