SPKB

Signal Peptide Knowledge Base

SPKB ID Signal sequence Length Organism
SPKB16845 MKFSSLAAATALVAGSVVA 19 Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) (Trichophyton mentagrophytes)
SPKB16846 MKSLSLLGVSSLALTSLA 18 Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) (Trichophyton mentagrophytes)
SPKB16847 MKPYTTLPGVAVLVSLLTQSAHA 23 Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) (Trichophyton mentagrophytes)
SPKB16848 MMASRRISVLSSLGLFACLLSPVVA 25 Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) (Trichophyton mentagrophytes)
SPKB16849 MIWKQPPRRMGEMGGSLSRRFGNAAASWAVWRVSRSCFSLLFFFYFFLFFSSSSL 55 Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) (Trichophyton mentagrophytes)
SPKB16850 MRLAASIAVALPVIGAASA 19 Trichophyton verrucosum (strain HKI 0517)
SPKB16851 MSPAPTDIVEEFTRRDWQGDDV 22 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii)
SPKB16852 MDRRQFLRTVGASALAVSTAAVVGSRPATA 30 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii)
SPKB16853 MAFSTIVVLFVAAVGFG 17 Trichinella spiralis (Trichina worm)
SPKB16854 MSVTTPRREASLLSRAVAVAAAAAATVALAAPAQA 35 Thermobifida alba (Thermomonospora alba)
SPKB16855 MYQSTLKTILLASALLILPASMSA 24 Xylanibacter ruminicola (strain ATCC 19189 / DSM 19721 / CIP 105475 / JCM 8958 / 23) (Prevotella ruminicola)
SPKB16856 MSLLRSASLLLVVVTAALPPCTLG 24 Haemonchus contortus (Barber pole worm)
SPKB16857 MLLLVLLFVFISATNA 16 Haemonchus contortus (Barber pole worm)
SPKB16858 MKTSMLAVFVALPLAFVLTAA 21 Pelinobius muticus (King baboon spider) (Citharischius crawshayi)
SPKB16859 MSPGGAGCSAGLLLTVGWLLLAGLQSTCG 29 Sus scrofa (Pig)
SPKB16860 MTRKQTPMTLALCALGLFAASAASALA 27 Thiomonas intermedia (strain K12) (Thiobacillus intermedius)
SPKB16861 MTEDHAVVRSDGGLSRRSFAAVAGTATVATALTSGVAAALPAPA 44 Streptomyces viridosporus (strain ATCC 14672 / DSM 40746 / JCM 4963 / KCTC 9882 / NRRL B-12104 / FH 1290) (Streptomyces ghanaensis)
SPKB16862 MRTLWIVAVLLLGVEG 16 Crotalus horridus (Timber rattlesnake)
SPKB16863 MKFPKNLFLVLFYTSWKFCDVCA 23 Tribolium castaneum (Red flour beetle)
SPKB16864 MHDAPAQRKRRRPGRIGPLPRSSRFARLKLLIASACAALLATLALPPGAAHA 52 Streptomyces sp
SPKB16865 MKKVLLFLIFLVSANLS 17 Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij)
SPKB16866 MNLTKMAVFAASLFCLA 17 Zobellia galactanivorans (strain DSM 12802 / CCUG 47099 / CIP 106680 / NCIMB 13871 / Dsij)
SPKB16867 MKAVVLTVAVFFLTGSQA 18 Marmota monax (Woodchuck)
SPKB16868 MTVLFILSAGLVAVFG 16 Penicillium aethiopicum
SPKB16869 MNHKFIALLLVVLCCALSVHQVSA 24 Bombus terrestris (Buff-tailed bumblebee) (Apis terrestris)
SPKB16870 MKLSAALLAIAAFANVASA 19 Schizophyllum commune (strain H4-8 / FGSC 9210) (Split gill fungus)
SPKB16871 MIQALLVTICLVGFPHQGSS 20 Cerberus rynchops (Dog-faced water snake)
SPKB16872 MVGLSRLAGGGLLLVLALLPLALDG 25 Naja atra (Chinese cobra)
SPKB16873 MLPVAVVLVVFAVAVTSA 18 Phytophthora sojae (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB16874 MRLTYVLLVAVTTLLVSCDA 20 Phytophthora sojae (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
First 458 459 460 461 462 463 464 Last

Faculty of Applied Sciences, Macao Polytechnic University, Macao, China.