SPKB

Signal Peptide Knowledge Base

SPKB ID Signal sequence Length Organism
SPKB16951 MTASTVALALFVASILG 17 Human herpesvirus 8 type P (isolate GK18) (HHV-8) (Kaposi's sarcoma-associated herpesvirus)
SPKB16952 MGKKEMIMVKGIPKIMLLISITFLLLSLINC 31 Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5)
SPKB16953 MKTKAVLMLMLLVLVAATLVQG 22 Panulirus argus (Caribbean spiny lobster) (Palinurus argus)
SPKB16954 MGLTETTLVLVSLAFFASAVA 21 Ixodes scapularis (Black-legged tick) (Deer tick)
SPKB16955 MAKVMRLIIFVCVALVAISVPAASS 25 Toxoplasma gondii (strain ATCC 50853 / GT1)
SPKB16956 MVIIWNIFLPAFLLVLAKASLRS 23 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
SPKB16957 MVPWRALSLPILLVSLRGYVCA 22 Mus musculus (Mouse)
SPKB16958 MDTSKTSFFLFSVLCSLQLVGA 22 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
SPKB16959 MASFCASKFLPGLLMLGLGLAVALA 25 Hemicentrotus pulcherrimus (Sea urchin) (Strongylocentrotus pulcherrimus)
SPKB16960 MSFLKKSLFLVLFLGFVSLSIC 22 Phyllomedusa sauvagei (Sauvage's leaf frog)
SPKB16961 MRALWIVAVCLIGAEG 16 Vipera renardi (Steppe viper) (Vipera ursinii renardi)
SPKB16962 MTSIPVSSFLLAALVLQYATSDA 23 Tabanus yao (Horsefly)
SPKB16963 MIEVLLVTICFTVFPYQGSP 20 Drysdalia coronoides (White-lipped snake) (Hoplocephalus coronoides)
SPKB16964 MSMMCYTLIIAFLIGIWA 18 Drysdalia coronoides (White-lipped snake) (Hoplocephalus coronoides)
SPKB16965 MQTPKRRRGAQGCPRSSPSPPLLLLVRAVWFCAALSVAAG 40 Crotalus adamanteus (Eastern diamondback rattlesnake)
SPKB16966 MIQVLLVTISLAVFPYQGSS 20 Crotalus adamanteus (Eastern diamondback rattlesnake)
SPKB16967 MRAEKRWHILLSMILLLITSSQC 23 Danio rerio (Zebrafish) (Brachydanio rerio)
SPKB16968 MQNIFLAATLLGAAFA 16 Zymoseptoria tritici (strain CBS 115943 / IPO323) (Speckled leaf blotch fungus) (Septoria tritici)
SPKB16969 MTDTNEKIRSLFLTALMVFSVFAGTIAFSGGAAA 34 Haloarcula hispanica (strain ATCC 33960 / DSM 4426 / JCM 8911 / NBRC 102182 / NCIMB 2187 / VKM B-1755)
SPKB16970 MTGNSDKVRSLFLTALMVFSVFA 23 Haloarcula hispanica (strain ATCC 33960 / DSM 4426 / JCM 8911 / NBRC 102182 / NCIMB 2187 / VKM B-1755)
SPKB16971 MMKKSMLLLFFLGMVSFSLA 20 Phlyctimantis maculatus (Red-legged running frog) (Hylambates maculatus)
SPKB16972 MRLTSILVLVIAATFHTTGTA 21 Phytophthora sojae (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB16973 MLTNGLISLLAIAGLATNAFA 21 Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) (Nematode-trapping fungus) (Didymozoophaga oligospora)
SPKB16974 MKGAIQFLGALAAVQAVSA 19 Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) (Nematode-trapping fungus) (Didymozoophaga oligospora)
SPKB16975 MYSLLIALLCAGTAVDAQA 19 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile)
SPKB16976 MARTLRYLLCGILALAAGSNA 21 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile)
SPKB16977 MKVLAPLILAGAASA 15 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile)
SPKB16978 MKSFTLTTLAALAGNAAA 18 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile)
SPKB16979 MGQKTLQGLVAAAALAASVANA 22 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile)
SPKB16980 MLTTTFALLTAALGVSA 17 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile)
First 563 564 565 566 567 568 569 Last

Faculty of Applied Sciences, Macao Polytechnic University, Macao, China.