SPKB

Signal Peptide Knowledge Base

SPKB ID Signal sequence Length Organism
SPKB36001 MGKLIKLITTLTVLVSLLQYCCE 23 Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)
SPKB36002 MWILIYLFIIWSSLRTWVTA 20 Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)
SPKB36003 MKFSTLSTVAAIAAFASA 18 Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)
SPKB36004 MLGFLSRGPSMKLCMGLACVLSLWNTVSG 29 Homo sapiens (Human)
SPKB36005 MSLLITSLAWGALLDPEVSS 20 Alternaria alternata (Alternaria rot fungus) (Torula alternata)
SPKB36006 MRALTSLSVVLLALISTVSA 20 Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt of alfalfa) (Verticillium albo-atrum)
SPKB36007 MNYEAEQPGANDDASGVAVALELARVLA 28 Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) (Verticillium wilt of alfalfa) (Verticillium albo-atrum)
SPKB36008 MKKLVLLQFLFFISFARG 18 Apis mellifera (Honeybee)
SPKB36009 MNKKTLLVIFIVTLLIADEVNS 22 Tityus discrepans (Venezuelan scorpion)
SPKB36010 MWTFAIVLAFLLIGLDEGEA 20 Tityus discrepans (Venezuelan scorpion)
SPKB36011 MKSTVKKRGWVIAGIVVVALA 21 Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)
SPKB36012 MKQNIKLGVIAALMLIVLTPVTSNA 25 Clostridioides difficile (strain R20291) (Peptoclostridium difficile)
SPKB36013 MVNETMKHQFKFNPLATAIFTLLCSGSIQSSYA 33 Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / JCM 6841 / CCUG 19606 / CIP 70.34 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81)
SPKB36014 MKRYLSLALAALVLTG 16 Yersinia pestis (strain D182038)
SPKB36015 MLPFHLVRTQAGRVIPVLLAALFLAG 26 Pectobacterium parmentieri (strain WPP163) (Pectobacterium wasabiae (strain WPP163))
SPKB36016 MINHKRLSVPRILTPVALAITLAA 24 Vibrio antiquarius (strain Ex25)
SPKB36017 MLPYKTLLLALGFFFTVQC 19 Phytophthora infestans (strain T30-4) (Potato late blight agent)
SPKB36018 MRLIAGVLAGFLVICEVTSTSES 23 Phytophthora infestans (strain T30-4) (Potato late blight agent)
SPKB36019 MRSIFYVALAFAVLARSSSVEA 22 Phytophthora infestans (strain T30-4) (Potato late blight agent)
SPKB36020 MRSAFYIFLVVAVLARCSVVAA 22 Phytophthora infestans (strain T30-4) (Potato late blight agent)
SPKB36021 MRWLIWTAVSTLVMLLAMTEVSAS 24 Phytophthora infestans (strain T30-4) (Potato late blight agent)
SPKB36022 MIRNALLVLVFVLIGTISA 19 Phytophthora infestans (strain T30-4) (Potato late blight agent)
SPKB36023 MRAIAILLAVVATIFASLHGVSA 23 Phytophthora infestans (strain T30-4) (Potato late blight agent)
SPKB36024 MQSRYILLVAVATLVSTQETSG 22 Phytophthora infestans (strain T30-4) (Potato late blight agent)
SPKB36025 MRLPSILVVAASTLFLHYGYTSA 23 Phytophthora infestans (strain T30-4) (Potato late blight agent)
SPKB36026 MKVSKAIVALAALCMALLAPAAG 23 Phytophthora infestans (strain T30-4) (Potato late blight agent)
SPKB36027 MRCNHTLCVVAITFLVSWSQTLS 23 Phytophthora infestans (strain T30-4) (Potato late blight agent)
SPKB36028 MRLAAFVLVAVAFAIIPDGRVSA 23 Phytophthora infestans (strain T30-4) (Potato late blight agent)
SPKB36029 MHFIYRVVLVLAAFALFKVDSISA 24 Phytophthora infestans (strain T30-4) (Potato late blight agent)
SPKB36030 MRACNTLLPTAIVLTSCDA 19 Phytophthora infestans (strain T30-4) (Potato late blight agent)
First 1198 1199 1200 1201 1202 1203 1204 Last

Faculty of Applied Sciences, Macao Polytechnic University, Macao, China.