SPKB

Signal Peptide Knowledge Base

SPKB ID Signal sequence Length Organism
SPKB25111 MTSLRRGNICWVAVCAALLTLTRG 24 Patiria pectinifera (Starfish) (Asterina pectinifera)
SPKB25112 MSSGGLLLLLGLLTLWEVLTPVSS 24 Drysdalia coronoides (White-lipped snake) (Hoplocephalus coronoides)
SPKB25113 MRALWIVAVCLIGVEG 16 Vipera renardi (Steppe viper) (Vipera ursinii renardi)
SPKB25114 MKSYLILNTLLLSLLKING 19 Schmidtea mediterranea (Freshwater planarian flatworm)
SPKB25115 MNYFILILVAALLILDVNC 19 Centruroides vittatus (Striped bark scorpion)
SPKB25116 MYAPPFVRAFGIAVLAVLPSFSSPATA 27 Hypocrea jecorina (strain QM6a) (Trichoderma reesei)
SPKB25117 MVAFSSLICALTSIASTLA 19 Hypocrea jecorina (strain QM6a) (Trichoderma reesei)
SPKB25118 MKANVILCLLAPLVAA 16 Hypocrea jecorina (strain QM6a) (Trichoderma reesei)
SPKB25119 MFWTVPVTLALASGASA 17 Hypocrea jecorina (strain QM6a) (Trichoderma reesei)
SPKB25120 MRLSLLVTLALTALIEA 17 Hypocrea jecorina (strain QM6a) (Trichoderma reesei)
SPKB25121 MRSLAILTTLLAGHAFA 17 Hypocrea jecorina (strain QM6a) (Trichoderma reesei)
SPKB25122 MARLAPHTLLLALFVFLFGSCTA 23 Hypocrea jecorina (strain QM6a) (Trichoderma reesei)
SPKB25123 MQFLAVAALLFTTALA 16 Hypocrea jecorina (strain QM6a) (Trichoderma reesei)
SPKB25124 MSAQRFLFLLVVTSLIAASLA 21 Bunodosoma granuliferum (Red warty sea anemone)
SPKB25125 MQFTLAAAAALFGASALA 18 Verticillium dahliae (Verticillium wilt)
SPKB25126 MDSKYLFVFLIFNVIVIDLCQG 22 Chaerilus tricostatus (Scorpion)
SPKB25127 MRLSSTTFVVLAAVLLASGTAVSKA 25 Phytophthora sojae (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB25128 MRGVFFVAVAVAIFARSSAEA 21 Phytophthora sojae (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB25129 MRFTLYGLLGFASLLHA 17 Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) (Nematode-trapping fungus) (Didymozoophaga oligospora)
SPKB25130 MRKKRYVWLKSILVAILVFGSGVWINTSNGTNAQA 35 Listeria monocytogenes serotype 1/2a (strain 10403S)
SPKB25131 MGYLVKLACGLLLPLATA 18 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile)
SPKB25132 MPASLLRFLALAGTAVG 17 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile)
SPKB25133 MKLTTSVALLAAAGAQA 17 Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126) (Thielavia terrestris)
SPKB25134 MKLYLAAFLGAVATPGAFA 19 Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126) (Thielavia terrestris)
SPKB25135 MLANGAIVFLAAALGVSG 18 Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126) (Thielavia terrestris)
SPKB25136 MQLLVGLLLAAVAARA 16 Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126) (Thielavia terrestris)
SPKB25137 MTAIFNFESLLFVILLTICTC 21 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
SPKB25138 MPSVTISSTMLAGLLLMLVPASSA 24 Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt)
SPKB25139 MQFTLAAAAALFGASALA 18 Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt)
SPKB25140 MVSFKSLLLAASAFTAVLG 19 Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt)
First 835 836 837 838 839 840 841 Last

Faculty of Applied Sciences, Macao Polytechnic University, Macao, China.