SPKB

Signal Peptide Knowledge Base

SPKB ID Signal sequence Length Organism
SPKB07831 MAQTRAWKSIMPLESLPGWLNAVVWGLLLLFCQVQG 36 Rattus norvegicus (Rat)
SPKB07832 MALARCVLAVILGVLSEVARA 21 Rattus norvegicus (Rat)
SPKB07833 MGSRFFLALFLALLVLGNEVQG 22 Rattus norvegicus (Rat)
SPKB07834 MLTPPLLLLLPLLSALVAG 19 Rattus norvegicus (Rat)
SPKB07835 MERLSGCRLRPWMLLLLLFPVQG 23 Rattus norvegicus (Rat)
SPKB07836 MAKARSGAAGLGLKLFLLLPLLG 23 Rattus norvegicus (Rat)
SPKB07837 MWHRALGPGWKLLLALALTSLQGARG 26 Mus musculus (Mouse)
SPKB07838 MSHQILLLLAMLTLGLA 17 Mus musculus (Mouse)
SPKB07839 MHNFSKLAVAFVAAASFASA 20 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB07840 MRVLVWIAGLAPLAVA 16 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB07841 MRLTYVLLVAVTTLLVSCDA 20 Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB07842 MKSFLQLVVVVAALLSVSTA 20 Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB07843 MRLTYFLTVIVVATLHAGGTA 21 Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB07844 MRLTSILVLVIAATFHTTGTA 21 Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB07845 MQPRVFLAVTLLALLASARA 20 Heterocephalus glaber (Naked mole rat)
SPKB07846 MKAVVLAVAVLFLTGSQA 18 Heterocephalus glaber (Naked mole rat)
SPKB07847 MKLLAMTVLLVTICSLDG 18 Heterocephalus glaber (Naked mole rat)
SPKB07848 MAFMSFINGFSTLFLVALLASSMMAAKG 28 Diospyros kaki (Kaki persimmon) (Diospyros chinensis)
SPKB07849 MAMGTHFGGLWLALLCMVSATMG 23 Diospyros kaki (Kaki persimmon) (Diospyros chinensis)
SPKB07850 MRSPRTFTFYFLLLVICSSEA 21 Mus musculus (Mouse)
SPKB07851 MAPKLFTFVSALSGLASLASA 21 Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)
SPKB07852 MFNRKTLLCTILLVLQAVIRSFC 23 Caenorhabditis elegans
SPKB07853 MKIHHFLTLLCTFLPLTTT 19 Caenorhabditis elegans
SPKB07854 MATWIVGKLIIASLILGIQA 20 Caenorhabditis elegans
SPKB07855 MRLIYVIAILLVSTCQA 17 Caenorhabditis elegans
SPKB07856 MRRLPIVLLLSVFSIANC 18 Caenorhabditis elegans
SPKB07857 MSRWLSLLLFAVQAVGG 17 Caenorhabditis elegans
SPKB07858 MRLWLGLLAVSNIALG 16 Caenorhabditis elegans
SPKB07859 MFSSRIWLLLAVTVGVCLA 19 Caenorhabditis elegans
SPKB07860 MSASILILATCHQVLA 16 Caenorhabditis elegans
First 259 260 261 262 263 264 265 Last

Faculty of Applied Sciences, Macao Polytechnic University, Macao, China.