SPKB

Signal Peptide Knowledge Base

SPKB ID Signal sequence Length Organism
SPKB38941 MSKLFRRVVTVLALTSMASSFA 22 Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC) (Chlamydophila caviae)
SPKB38942 MKLSRLALLSVFALASAPSWA 21 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
SPKB38943 MTLYRSLWKKGCMLLLSLVLSLTAFIGSPSNTASAA 36 Cytobacillus firmus (Bacillus firmus)
SPKB38944 MKSLLACLALMIAGIATA 18 Bacillus subtilis (strain 168)
SPKB38945 MVVMKKKRILIVSAIVLLFLTVASA 25 Bacillus subtilis (strain 168)
SPKB38946 MKKRRKICYCNTALLLMILLAG 22 Bacillus subtilis (strain 168)
SPKB38947 MPIPFKPVLAVAAIAQAFPAFA 22 Neisseria meningitidis serogroup C
SPKB38948 MSMKTKAAFHLVLFGLA 17 Bacillus subtilis (strain 168)
SPKB38949 MEKRDSVALHWRLLLLLLLLMPPPTHQGRA 30 Mus musculus (Mouse)
SPKB38950 MKARLGSLLVLATLVTASNA 20 Rattus norvegicus (Rat)
SPKB38951 MKKTIMASSLAVALGVTGYAAGTGHQAHA 29 Staphylococcus aureus (strain N315)
SPKB38952 MKVLVLGLCRTGTSS 15 Aspergillus versicolor
SPKB38953 MKLPTFLIGFVALLVTSNGSA 21 Plasmopara viticola (Downy mildew of grapevine) (Botrytis viticola)
SPKB38954 MKISNLLGVLVVFLAVVKG 19 Plasmopara viticola (Downy mildew of grapevine) (Botrytis viticola)
SPKB38955 MKCLKTLLVSTTLLTAFSLNA 21 Alteromonas sp. (strain LOR)
SPKB38956 MAESDRLLGGYDPNAGYSAHAGA 23 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
SPKB38957 MAESDRLLGGYDPNAGYSAHAGA 23 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
SPKB38958 MSENRPEPVAAETSAATTARHSQADAGA 28 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
SPKB38959 MSENRPEPVAAETSAATTARHSQADAGA 28 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
SPKB38960 MRLVRLLGMVLTILAAGLLLGPPAGA 26 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
SPKB38961 MESPMTSTLHRTPLATAGLALVVALGG 27 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
SPKB38962 MTRPRPPLGPAMAGA 15 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
SPKB38963 MSLRLVSPIKAFADGIVAVAIAVVLMFGLANTPRAVAA 38 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
SPKB38964 MKFARSGAAVSLLAAGTLVLTA 22 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
SPKB38965 MRWIGLSTGLVSAMLVAGLVA 21 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
SPKB38966 MGVPSPVRRVCVTVGALVALACMVLA 26 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
SPKB38967 MAAMWRRRPLSSALLSFGLLLGGLPLAAPPLAGA 34 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
SPKB38968 MAAMWRRRPLSSALLSFGLLLGGLPLAAPPLAGA 34 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
SPKB38969 MNYAVLPPELNSLRMFTGAGSAPMLAA 27 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
SPKB38970 MNYAVLPPELNSLRMFTGAGSAPMLAA 27 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
First 1296 1297 1298 1299 1300 1301 1302 Last

Faculty of Applied Sciences, Macao Polytechnic University, Macao, China.