SPKB

Signal Peptide Knowledge Base

SPKB ID Signal sequence Length Organism
SPKB18976 MKKSLVLKASVAVATLVPMLSFA 23 Enterobacteria phage M13 (Bacteriophage M13)
SPKB19113 MERIVIALAIINIVKG 16 Influenza A virus (strain A/Mallard/Ohio/556/1987 H5N9)
SPKB19114 MLGLTEA 7 Influenza C virus (strain C/Yamagata/4/1988)
SPKB19115 MSKNWFPLLCASVLVVYVSIASSSTGTASG 30 Rhesus cytomegalovirus (strain 68-1) (RhCMV)
SPKB19116 MGPGLWVVMGVLVGVAGG 18 Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
SPKB19117 MARGAGLVFFVGVWVVSCLA 20 Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes simplex virus 2)
SPKB19196 MTRLPILLLLISLVYA 16 Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
SPKB19209 MKKLFVVLVVMPLIYGDNFPCSKLTNRT 28 Porcine transmissible gastroenteritis coronavirus (strain NEB72-rt) (TGEV)
SPKB19210 MSKRVLIIAVVVYLVFT 17 Dugbe virus (isolate ArD44313) (DUGV)
SPKB19211 M 1 Feline leukemia virus (strain C/FS246)
SPKB19218 MASLKMLICVCVAILIPSTLS 21 Infectious laryngotracheitis virus (strain 632) (ILTV) (Gallid herpesvirus 1)
SPKB19236 MRPRPLLLLFLLFLPMLPAPPTG 23 Hepatitis E virus genotype 2 (isolate Human/Mexico) (HEV-2)
SPKB19247 MGKFLATLILFFQFCPLILG 20 Human T-cell leukemia virus 1 (isolate Caribbea CH subtype A) (HTLV-1)
SPKB19248 MGKFLATLILFFQFCPLILS 20 Human T-cell leukemia virus 1 (isolate Zaire EL subtype B) (HTLV-1)
SPKB19249 MLSLIMRTVIALSYIFCLAFG 21 Influenza A virus (strain A/Equine/Jillin/1/1989 H3N8)
SPKB19251 MPRPRPRALRGSSPGWALVAAVAVGAALLMATLAVA 36 Herpesvirus ateles type 1 (strain Lennette)
SPKB19252 MAPPAAKSRASRVAPLTSLVSMLAAAAAAVALCAAFAEA 39 Saimiriine herpesvirus 1 (strain MV-5-4-PSL) (SaHV-1) (Marmoset herpesvirus)
SPKB19253 MLLWYTTASIMRYLMVFMLF 20 Cercopithecine herpesvirus 9 (strain DHV) (CeHV-9) (Simian varicella virus)
SPKB19255 MRCSHKLGRFLTPHSCFWWLFLLCTGLSWSFA 32 Porcine reproductive and respiratory syndrome virus (strain Lelystad) (PRRSV)
SPKB19257 MRPRPILLLLLMFLPMLPA 19 Hepatitis E virus genotype 1 (isolate Human/Myanmar/HEVNE8L) (HEV-1)
SPKB19260 MGGAAARLGAVILFVVIVGLHGVRG 25 Human herpesvirus 1 (strain F) (HHV-1) (Human herpes simplex virus 1)
SPKB19308 MKAKLLVLLCTFTATYA 17 Influenza A virus (strain A/China:Nanchang/11/1996 H1N1)
SPKB19312 MKTTIILILLTHWVYS 16 Influenza A virus (strain A/Equine/Suffolk/1989 H3N8)
SPKB19349 MGKSGLYFSLICFYTLFPSSFG 22 Human T-cell leukemia virus 3 (strain Pyl43) (HTLV-3)
SPKB19352 MDIRAIVISLLISTCVQA 18 Influenza A virus (strain A/Gull/Minnesota/945/1980 H13N6)
SPKB19370 MKAKLLILLCALSATDA 17 Influenza A virus (strain A/Hickox/1940 H1N1)
SPKB19385 MKYTLLFCVVFATVSFGFADNER 23 Bat coronavirus 512/2005 (BtCoV) (BtCoV/512/2005)
SPKB19387 MGKFCLYFCLIYILFSASSG 20 Human T-cell leukemia virus 3 (strain 2026ND) (HTLV-3)
SPKB19404 MLIIFLFFNFC 11 Human coronavirus HKU1 (isolate N5) (HCoV-HKU1)
SPKB19450 MLIIFLFFNFC 11 Human coronavirus HKU1 (isolate N2) (HCoV-HKU1)
First 19 20 21 22 23 24 25 Last

Faculty of Applied Sciences, Macao Polytechnic University, Macao, China.