SPKB

Signal Peptide Knowledge Base

SPKB ID Signal sequence Length Organism
SPKB22279 MMRRPWLLSALVAWVKLPSVQG 22 Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus) (Fusarium verticillioides)
SPKB22280 MKLSFLSLVLAIILVMALMYTPHAEA 26 Tetramorium bicarinatum (Tramp ant)
SPKB22281 MAAYLLAVAILFCIQGWPSGTVQG 24 Gloydius tsushimaensis (Tsushima Island pitviper) (Agkistrodon tsushimaensis)
SPKB22282 MLFLRLFIFTPFLILANCQA 20 Caenorhabditis elegans
SPKB22283 MRRNILTALACSWLTAHA 18 Aspergillus ruber (strain CBS 135680)
SPKB22284 MLSLKAFLALSLSIHLSQG 19 Penicillium roqueforti
SPKB22286 MKANVILCLLAPLVAA 16 Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) (Trichoderma reesei)
SPKB22287 MQFTKLATVLIVSLMGSAAIA 21 Trichophyton interdigitale (strain MR816)
SPKB22288 MQLKKQLIVIFFTYFIVVNESEA 23 Mesobuthus gibbosus (Mediterranean checkered scorpion) (Buthus gibbosus)
SPKB22289 MLASLPASLALVVALATSASAHA 23 Pycnoporus cinnabarinus (Cinnabar-red polypore) (Trametes cinnabarina)
SPKB22290 MIPVFLAAIAVFLPLTSG 18 Pycnoporus cinnabarinus (Cinnabar-red polypore) (Trametes cinnabarina)
SPKB22291 MPSLRLLAILTTLLAVVLMATQSSA 25 Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
SPKB22292 MLINAARLLLPAAALVHLSLAWA 23 Ustilaginoidea virens (Rice false smut fungus) (Villosiclava virens)
SPKB22293 MFSKATLFFTAAVVIVAAGATPTTS 25 Pleurotus ostreatus (strain PC15) (Oyster mushroom)
SPKB22294 MLSHPMKLLFFVFALSALLAAA 22 Pleurotus ostreatus (strain PC15) (Oyster mushroom)
SPKB22295 MMFSKPVVLATTALATFAAA 20 Pleurotus ostreatus (strain PC15) (Oyster mushroom)
SPKB22296 MFSIRIATVVLAASALLAAA 20 Pleurotus ostreatus (strain PC15) (Oyster mushroom)
SPKB22297 MYSQSMVLLAAAFASFVAA 19 Pleurotus ostreatus (strain PC15) (Oyster mushroom)
SPKB22298 MLFKQAILVATTLTTLAVA 19 Pleurotus ostreatus (strain PC15) (Oyster mushroom)
SPKB22299 MKFTSVIALVATAATLVGA 19 Pleurotus ostreatus (strain PC15) (Oyster mushroom)
SPKB22300 MFQSILFLAFYGRPVFGSAA 20 Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
SPKB22301 MKHIVIIGGGFAGVST 16 Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
SPKB22302 MKSLFLTGLLSALTWASEFA 20 Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
SPKB22303 MMGLPLMAVPMLLDTGADP 19 Pestalotiopsis fici (strain W106-1 / CGMCC3.15140)
SPKB22304 MEANVGFLTLCLAITLVRFLM 21 Prunus mume (Japanese apricot) (Armeniaca mume)
SPKB22305 MATSTNSREFLIFICVLTLLVVRSEA 26 Medicago truncatula (Barrel medic) (Medicago tribuloides)
SPKB22306 MASWRMLCFVLLFTSILICHDA 22 Medicago truncatula (Barrel medic) (Medicago tribuloides)
SPKB22307 MKFMAKIELSRHIPLVTLIVLVLCITPPIFA 31 Medicago truncatula (Barrel medic) (Medicago tribuloides)
SPKB22308 MEAPAQLLFLLLLWLPDTTRE 21 Homo sapiens (Human)
SPKB22309 MDMRVPAQLLGLLLLWLPGVRF 22 Homo sapiens (Human)
First 600 601 602 603 604 605 606 Last

Faculty of Applied Sciences, Macao Polytechnic University, Macao, China.