SPKB

Signal Peptide Knowledge Base

SPKB ID Signal sequence Length Organism
SPKB25125 MQFTLAAAAALFGASALA 18 Verticillium dahliae (Verticillium wilt)
SPKB25126 MDSKYLFVFLIFNVIVIDLCQG 22 Chaerilus tricostatus (Scorpion)
SPKB25127 MRLSSTTFVVLAAVLLASGTAVSKA 25 Phytophthora sojae (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB25128 MRGVFFVAVAVAIFARSSAEA 21 Phytophthora sojae (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB25129 MRFTLYGLLGFASLLHA 17 Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) (Nematode-trapping fungus) (Didymozoophaga oligospora)
SPKB25130 MRKKRYVWLKSILVAILVFGSGVWINTSNGTNAQA 35 Listeria monocytogenes serotype 1/2a (strain 10403S)
SPKB25131 MGYLVKLACGLLLPLATA 18 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile)
SPKB25132 MPASLLRFLALAGTAVG 17 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile)
SPKB25133 MKLTTSVALLAAAGAQA 17 Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126) (Thielavia terrestris)
SPKB25134 MKLYLAAFLGAVATPGAFA 19 Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126) (Thielavia terrestris)
SPKB25135 MLANGAIVFLAAALGVSG 18 Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126) (Thielavia terrestris)
SPKB25136 MQLLVGLLLAAVAARA 16 Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126) (Thielavia terrestris)
SPKB25137 MTAIFNFESLLFVILLTICTC 21 Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
SPKB25138 MPSVTISSTMLAGLLLMLVPASSA 24 Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt)
SPKB25139 MQFTLAAAAALFGASALA 18 Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt)
SPKB25140 MVSFKSLLLAASAFTAVLG 19 Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt)
SPKB25141 MLKSLVVLLLTSRVIA 16 Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt)
SPKB25142 MRPDVFVLFTAFLGPAAA 18 Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt)
SPKB25143 MVSFSTLLTACTAITGALG 19 Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt)
SPKB25144 MVCFSSLFVAASAIAGVFA 19 Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt)
SPKB25145 MSFIKSLLLAAAAVASVSA 19 Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt)
SPKB25146 MKTIIAAIFLGILMHAFA 18 Dipetalogaster maximus (Blood-sucking bug)
SPKB25147 MNHKFIALLLVVLCCALAVHQVSA 24 Bombus ignitus (Bumblebee)
SPKB25148 MLLCVSCLSVNG 12 Mus musculus (Mouse)
SPKB25149 MKKLALLGALALSVLSLPTFA 21 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
SPKB25150 MHLMLVLLGLAALLGTSQS 19 Dromaius novaehollandiae (Emu)
SPKB25151 MQLSGILSWLLSWLWA 16 Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
SPKB25152 MESLAQLPGIFLPLAGCVLALSLSALLA 28 Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
SPKB25153 MFRTILLCSLGLTTLSSA 18 Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
SPKB25154 MALVHLTALAACGLLLVILRA 21 Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
First 734 735 736 737 738 739 740 Last

Faculty of Applied Sciences, Macao Polytechnic University, Macao, China.