SPKB

Signal Peptide Knowledge Base

Home

Search

Browse

Tools

Statistics

Downloads

Help

Submit
  1. Home
  2. Browse
  3. Classified Browse
SPKB ID Signal sequence Length Organism
SPKB28765 MRMSKALAAVVAISVSLSAAAMGVDA 26 Oryza sativa subsp. japonica (Rice)
SPKB28766 MKATFVLACLLVIAAVSHA 19 Caenorhabditis elegans
SPKB28767 MLKSFVILFAFLASASA 17 Caenorhabditis elegans
SPKB28768 MNLKEWLLFSDAVFFAQGTLA 21 Torulaspora delbrueckii (Yeast) (Candida colliculosa)
SPKB28769 MSYIYLFITAAAVTGALG 18 Saccharomyces mikatae (Yeast)
SPKB28772 MLGLYLSSLFFAFFMAQVFA 20 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
SPKB28773 MHKPLRWLITIAFYVSNVILIGYSLS 26 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
SPKB28774 MKFSSGKSIIFATIASLALS 20 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
SPKB28775 MVKSVLASALFAVSALA 17 Aspergillus aculeatus
SPKB28776 MRLSNALVLVAACISSVVA 19 Agaricus bisporus (White button mushroom)
SPKB28777 MRFSNAFVLVAACISSVLA 19 Agaricus bisporus (White button mushroom)
SPKB28778 MKVTAAFASLLLTAFA 16 Aspergillus niger
SPKB28779 MVRQLILISSLLAAVA 16 Aspergillus niger
SPKB28780 MAGLKSFLASSWLLPVACGASQSIV 25 Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
SPKB28781 MKFFATIAALVVGAVA 16 Aureobasidium pullulans (Black yeast) (Pullularia pullulans)
SPKB28783 MARGTALLGLTSLLLGLVNG 20 Humicola insolens (Soft-rot fungus)
SPKB28784 MKHSVLAGLFATGALA 16 Humicola insolens (Soft-rot fungus)
SPKB28785 MLFPVLHLPKAMKFSSFSLIASSLLSLVAA 30 Pichia angusta (Yeast) (Hansenula polymorpha)
SPKB28786 MLSMQVVSLISLLVSVCLA 19 Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)
SPKB28787 MKFLNTFSLLSLAIIGS 17 Neocallimastix patriciarum (Rumen fungus)
SPKB28788 MKLSMTLSLFAATAMG 16 Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi)
SPKB28789 MNLTLLLLALIFSPSLIFS 19 Schwanniomyces occidentalis (Yeast) (Debaryomyces occidentalis)
SPKB28790 MVHILSSALSLLRLGAA 17 Sclerotinia sclerotiorum (White mold) (Whetzelinia sclerotiorum)
SPKB28791 MGKFHSFVNVVALSLSLSGRVFG 23 Trametes versicolor (White-rot fungus) (Coriolus versicolor)
SPKB28792 MGRFSSLCALTAVIHSFGRVSA 22 Trametes versicolor (White-rot fungus) (Coriolus versicolor)
SPKB28793 MKLTKLVALAGAALA 15 Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
SPKB28794 MFPGARILATLTLALHLLHGTHA 23 Pleurotus ostreatus (Oyster mushroom) (White-rot fungus)
SPKB28795 MRSFAPWLVSLLGASAVVAA 20 Aspergillus niger
SPKB28796 MFKHTLGAAALSLLFNSNA 19 Albifimbria verrucaria (Myrothecium leaf spot and pod blight fungus) (Myrothecium verrucaria)
SPKB28800 MGPLSAPPCTQHITWKGLLLTASLLNFWNPPTTA 34 Homo sapiens (Human)
First 755 756 757 758 759 760 761 Last

Creative Commons License This work is licensed under a Creative Commons Attribution 4.0 International License.

Faculty of Applied Sciences, Macao Polytechnic University, Macao, China.