SPKB

Signal Peptide Knowledge Base

SPKB ID Signal sequence Length Organism
SPKB41535 MGRFISVSFGLLVVFLSLSGAGA 23 Trimeresurus stejnegeri (Chinese green tree viper) (Viridovipera stejnegeri)
SPKB41536 MGQFIFVSFGLLVVLLSLSGAGA 23 Trimeresurus stejnegeri (Chinese green tree viper) (Viridovipera stejnegeri)
SPKB41537 MGRFIFMSFGFLVVAVSLSGTGA 23 Trimeresurus stejnegeri (Chinese green tree viper) (Viridovipera stejnegeri)
SPKB41538 MGRFIFVSFGLLVVFLSLSGSGA 23 Trimeresurus stejnegeri (Chinese green tree viper) (Viridovipera stejnegeri)
SPKB41539 MGRFIFVSFGLLVVFLSLSGTGA 23 Trimeresurus stejnegeri (Chinese green tree viper) (Viridovipera stejnegeri)
SPKB41540 LSLSGTAA 8 Trimeresurus stejnegeri (Chinese green tree viper) (Viridovipera stejnegeri)
SPKB41541 MGRLIFVSFGLLVVFLSLSGTAA 23 Trimeresurus stejnegeri (Chinese green tree viper) (Viridovipera stejnegeri)
SPKB41542 MGRFIFVSFGLLVVFLSLSGTAA 23 Trimeresurus stejnegeri (Chinese green tree viper) (Viridovipera stejnegeri)
SPKB41543 MGRFIFVSFGLLVVAASLSGTGA 23 Trimeresurus stejnegeri (Chinese green tree viper) (Viridovipera stejnegeri)
SPKB41544 MARFVAVALLVLLSLSGLEA 20 Plecturocebus moloch (Dusky titi monkey) (Callicebus moloch)
SPKB41545 MACSVVVALLALLSLSGLEA 20 Mico humeralifer (Black and white tassel-ear marmoset) (Callithrix humeralifera)
SPKB41546 MASSVVVALLVLLSLSGLEA 20 Callithrix penicillata (Black-pencilled marmoset)
SPKB41547 MARSVVAALLVLLSLSGLEA 20 Saimiri sciureus (Common squirrel monkey)
SPKB41548 MARSVVAALLVLLSLSGLEA 20 Saimiri ustus (Golden-backed squirrel monkey)
SPKB41567 MRALLLAFQLLSVVAA 16 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Ashbya gossypii)
SPKB41568 MRAISKLFVFTVLVLGSLQ 19 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Ashbya gossypii)
SPKB41569 MVYVSWSAAALLCASFFSTVVLA 23 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Ashbya gossypii)
SPKB41570 MRVSVWYGLLHAAAWTRA 18 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Ashbya gossypii)
SPKB41571 MDRRKLIFGKFWLFGLLNNVLYVVILAAA 29 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Ashbya gossypii)
SPKB41572 MYWKKLLFAIASAAALA 17 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Ashbya gossypii)
SPKB41573 MLEILLFLCVIIQRSHINA 19 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Ashbya gossypii)
SPKB41574 MGSFLLCLLLVQLQWCLC 18 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Ashbya gossypii)
SPKB41575 MQNVASWLLALVVAVVQG 18 Eremothecium gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Ashbya gossypii)
SPKB41576 MDLVRLTSLLPPSVMG 16 Oryza sativa subsp. japonica (Rice)
SPKB41577 MARFLLGAAAIALLAGVSSLLLMVPFAEA 29 Oryza sativa subsp. japonica (Rice)
SPKB41578 MFIILKFLISFFLICNFFNYNDHFASG 27 Dictyostelium discoideum (Social amoeba)
SPKB41579 SSGGLLLLLGLLTLCAELIPVSS 23 Bungarus candidus (Malayan krait)
SPKB41580 MQMYHVVLGCSLAILLVILDIPQASC 26 Periplaneta americana (American cockroach) (Blatta americana)
SPKB41581 MGFWKLSPFLAIGLLVMYQAGILQA 25 Canis lupus familiaris (Dog) (Canis familiaris)
SPKB41582 TSQGTTPDKVQLEVNCISNLPNNEVEETDLLRELEMIEENLFGKELSFVPEENRNSRHKRCMGYDIECNERLHCCADLECVKTSGRWWYKKTYCRRKSG 100 Macrothele gigas (Japanese funnel web spider)
First 1022 1023 1024 1025 1026 1027 1028 Last

Faculty of Applied Sciences, Macao Polytechnic University, Macao, China.