SPKB

Signal Peptide Knowledge Base

SPKB ID Signal sequence Length Organism
SPKB16965 MQTPKRRRGAQGCPRSSPSPPLLLLVRAVWFCAALSVAAG 40 Crotalus adamanteus (Eastern diamondback rattlesnake)
SPKB16966 MIQVLLVTISLAVFPYQGSS 20 Crotalus adamanteus (Eastern diamondback rattlesnake)
SPKB16967 MRAEKRWHILLSMILLLITSSQC 23 Danio rerio (Zebrafish) (Brachydanio rerio)
SPKB16968 MQNIFLAATLLGAAFA 16 Zymoseptoria tritici (strain CBS 115943 / IPO323) (Speckled leaf blotch fungus) (Septoria tritici)
SPKB16969 MTDTNEKIRSLFLTALMVFSVFAGTIAFSGGAAA 34 Haloarcula hispanica (strain ATCC 33960 / DSM 4426 / JCM 8911 / NBRC 102182 / NCIMB 2187 / VKM B-1755)
SPKB16970 MTGNSDKVRSLFLTALMVFSVFA 23 Haloarcula hispanica (strain ATCC 33960 / DSM 4426 / JCM 8911 / NBRC 102182 / NCIMB 2187 / VKM B-1755)
SPKB16971 MMKKSMLLLFFLGMVSFSLA 20 Phlyctimantis maculatus (Red-legged running frog) (Hylambates maculatus)
SPKB16972 MRLTSILVLVIAATFHTTGTA 21 Phytophthora sojae (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB16973 MLTNGLISLLAIAGLATNAFA 21 Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) (Nematode-trapping fungus) (Didymozoophaga oligospora)
SPKB16974 MKGAIQFLGALAAVQAVSA 19 Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) (Nematode-trapping fungus) (Didymozoophaga oligospora)
SPKB16975 MYSLLIALLCAGTAVDAQA 19 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile)
SPKB16976 MARTLRYLLCGILALAAGSNA 21 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile)
SPKB16977 MKVLAPLILAGAASA 15 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile)
SPKB16978 MKSFTLTTLAALAGNAAA 18 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile)
SPKB16979 MGQKTLQGLVAAAALAASVANA 22 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile)
SPKB16980 MLTTTFALLTAALGVSA 17 Thermothelomyces thermophilus (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile)
SPKB16981 MKGLFSAAALSLAVGQASA 19 Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126) (Thielavia terrestris)
SPKB16982 MKSFTIAALAALWAQEAAA 19 Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126) (Thielavia terrestris)
SPKB16983 MRTLWIVAVLLLGVEG 16 Bothrops moojeni (Lance-headed viper) (Caissaca)
SPKB16984 MFTLKKPLLLLFFLGTVSLSLC 22 Amolops jingdongensis (Chinese torrent frog)
SPKB16985 MATPQSVFVFAICILMITELILA 23 Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
SPKB16986 MSSQFLLAFFLVLLVLGYEVQG 22 Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
SPKB16987 MQLIHFIVGLAMLISLSLA 19 Caenorhabditis elegans
SPKB16988 MELRARGWWLLYAAAVLVACARG 23 Bos taurus (Bovine)
SPKB16989 MRARLILSSLLLASLAG 17 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
SPKB16990 MSRQSTDTAVSSQRLLASAIGVAITAIAAPQAAQA 35 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
SPKB16991 MNRTYDIVIAGGGVIGAS 18 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
SPKB16992 MKFFLILGFCLLPLIAQG 18 Dromaius novaehollandiae (Emu)
SPKB16993 MALFSVLSNALSELPVSIWLAAA 23 Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
SPKB16994 MTRLATLITLAGLLAVSPGAYA 22 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
First 462 463 464 465 466 467 468 Last

Faculty of Applied Sciences, Macao Polytechnic University, Macao, China.