SPKB

Signal Peptide Knowledge Base

SPKB ID Signal sequence Length Organism
SPKB17791 MVSFTSIVTAVVALAGSALA 20 Pyricularia grisea (Crabgrass-specific blast fungus) (Magnaporthe grisea)
SPKB17792 MKSAAYLAALAAVLPAYVNA 20 Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) (White-rot fungus) (Sporotrichum pruinosum)
SPKB17793 MAFSWLSFVLLALPVLALA 19 Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) (White-rot fungus) (Sporotrichum pruinosum)
SPKB17794 MVNTSLLAALTAYAVAVSA 19 Aspergillus oryzae (Yellow koji mold)
SPKB17795 MHSFASLLAYGLAASATLASA 21 Aspergillus tubingensis
SPKB17796 MHSFASLLAYGLAASATLASA 21 Aspergillus niger
SPKB17797 MRQIPLVVVLLLAYAARLQG 20 Plasmopara viticola (Downy mildew of grapevine) (Botrytis viticola)
SPKB17798 MKKLLISAVSALVLGSGAALA 21 Rhodobacter capsulatus (Rhodopseudomonas capsulata)
SPKB17799 MRKKQKLPFDKLAIALMSTSILLNAQSDIKA 31 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
SPKB17800 MRKKQKLPFDKLAIALMSTSILLNAQSDIKA 31 Streptococcus pyogenes serotype M3 (strain SSI-1)
SPKB17801 MNKKKLGIRLLSLLALGGFVLANPVFA 27 Streptococcus pyogenes serotype M3 (strain SSI-1)
SPKB17802 MSNKKTFKKYSRVAGLLTAALIIGNLVTANAES 33 Streptococcus pyogenes serotype M3 (strain SSI-1)
SPKB17803 MNFATKVSLLLLAIAVIVIVEGGEG 25 Hormurus waigiensis (Australian rainforest scorpion) (Liocheles waigiensis)
SPKB17804 MMNVITVVGIILSVVCTISDA 21 Olivierus martensii (Manchurian scorpion) (Mesobuthus martensii)
SPKB17805 MKTSVVFVIAGLALLSVACYA 21 Grammostola rosea (Chilean rose tarantula) (Grammostola spatulata)
SPKB17806 MKLLAATVLLLTICSLEG 18 Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
SPKB17807 MIFVGETMERANHSLVRLRR 20 Latrodectus hesperus (Western black widow spider)
SPKB17808 MKLLAATVLLLTICSLEG 18 Gorilla gorilla gorilla (Western lowland gorilla)
SPKB17809 MDLKMLLIFIAFLLPSVLG 19 Gallus gallus (Chicken)
SPKB17810 MALLPRLAAGGLLLLLALAALDG 23 Atractaspis irregularis (Variable burrowing asp) (Elaps irregularis)
SPKB17811 MGKTMWARAVFLCFSVGTLLWQEVLT 26 Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
SPKB17812 MSKLGVLLTICLLLLPLTA 19 Conus consors (Singed cone)
SPKB17813 MRIWSLTRILTFIVIFNFAEA 21 Scolopendra mutilans (Chinese red-headed centipede) (Scolopendra subspinipes mutilans)
SPKB17814 MKHLIVAVVLLSALAICTSA 20 Plectreurys tristis (Spider) (Plectreurys bispinosus)
SPKB17815 MKTIVYLIVSILLLSSTVLVLA 22 Macrothele raveni (Funnel-web spider)
SPKB17816 MKTFTLIAILTCAVLVIFHAAAA 23 Coremiocnemis tropix (Australian tarantula spider)
SPKB17817 YRIASSSIAKMKTAVFLVGLLFLGLVFA 28 Lineus longissimus (Bootlace worm) (Ascaris longissima)
SPKB17818 MKWGALLCIFGFLAFCSVLDRGLG 24 Scorpiops jendeki (Scorpion) (Scorpiops hardwickii jendeki)
SPKB17819 MLFPTALIFGCWALVIEG 18 Loxosceles intermedia (Brown spider)
SPKB17820 MIQVLLVTICLAVFPYQGNS 20 Trimeresurus stejnegeri (Chinese green tree viper) (Viridovipera stejnegeri)
First 591 592 593 594 595 596 597 Last

Faculty of Applied Sciences, Macao Polytechnic University, Macao, China.