SPKB

Signal Peptide Knowledge Base

SPKB ID Signal sequence Length Organism
SPKB25153 MFRTILLCSLGLTTLSSA 18 Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
SPKB25154 MALVHLTALAACGLLLVILRA 21 Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7)
SPKB25155 MRTPAIVLALAPAAAFGQAAL 21 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB25156 MSLKSLIAATILAAPLVAGHG 21 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB25157 MKASSVLLGLAPLAALA 17 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB25158 MRSIISAFILSLNFCTQPLVRG 22 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB25159 MQILTWALAALAAIPAVTA 19 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB25160 MKSFSLLASAGLATLASLPLTMA 23 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB25161 MLPRLATVLLSALGASA 17 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB25162 MLPITVVTLFAALAAA 16 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB25163 MVSFTTILVAATAALVAA 18 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB25164 MKTSAALLFLVSLASA 16 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB25165 MIKTLTAAITLLAAGGVVA 19 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB25166 MKYTSAILISAFAATNVFA 19 Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) (Rice blast fungus) (Magnaporthe oryzae)
SPKB25167 MKKRKRRTFKRFIAAFLVLSLMISLLPADVLA 32 Bacillus spizizenii (strain DSM 15029 / JCM 12233 / NBRC 101239 / NRRL B-23049 / TU-B-10) (Bacillus subtilis subsp. spizizenii)
SPKB25168 MESLFIFAFGMMLSSASA 18 Cupiennius salei (American wandering spider)
SPKB25169 MARGLAVFFLLAGACLALA 19 Eriocheir sinensis (Chinese mitten crab)
SPKB25170 TGVES 5 Mesobuthus eupeus (Lesser Asian scorpion) (Buthus eupeus)
SPKB25171 MRLQFFLVMAVATLATISA 19 Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB25172 MMQWSAILIRTCFSGSGGEA 20 Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB25173 MRQYCLLLIVLALAAA 16 Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB25174 MRPYFTLLLALAFILACTNLVEA 23 Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines)
SPKB25175 MFAIALLSFLVVLINA 16 Caenorhabditis elegans
SPKB25176 MRSSLLLLVFFLSIGWA 17 Caenorhabditis elegans
SPKB25177 MSRWKVVILCLLSFMFEIGHA 21 Caenorhabditis elegans
SPKB25178 MRRFSNICVILFSFLYATGHG 21 Caenorhabditis elegans
SPKB25179 MLKFTAISFVLLNAAES 17 Caenorhabditis elegans
SPKB25180 MRFILLIALVFAVLDGINC 19 Caenorhabditis elegans
SPKB25181 MFSTRGVLLLLSLMAAVAA 19 Caenorhabditis elegans
SPKB25182 MRNSRFCAILAVISAISVSYVLA 23 Caenorhabditis elegans
First 596 597 598 599 600 601 602 Last

Faculty of Applied Sciences, Macao Polytechnic University, Macao, China.